Solution nmr structure of putative lipoprotein from pseudomonas syringae gene locus pspto2350. northeast structural genomics target psr76a.
PDB DOI: 10.2210/pdb2k57/pdb
Classification: structural genomics, unknown function Organism(s): Pseudomonas Syringae Pv. Phaseolicola 1448A
Deposited: 2008-06-25 Deposition Author(s): Acton, T.B. , Aramini, J.A. , Baran, M.C. , Hang, D. , Jiang, M. , Liu, J. , Maglaqui, M. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Rossi, P. , Rost, B. , Wang, D. , Xiao, R.
Method: SOLUTION NMR Resolution: N.A.
Solution nmr structure of putative lipoprotein from pseudomonas syringae gene locus pspto2350. northeast structural genomics target psr76a.
Acton, T.B. , Aramini, J.A. , Baran, M.C. , Hang, D. , Jiang, M. , Liu, J. , Maglaqui, M. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Rossi, P. , Rost, B. , Wang, D. , Xiao, R.
Primary Citation of Related Structures: 2K57
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Putative Lipoprotein | A | 61 | Pseudomonas Syringae Pv. Phaseolicola 1448A | MASPTVITLNDGREIQAVDTPKYDEESGFYEFKQLDGKQTRINKDQVRTVKDLLEHHHHHH |
Method: SOLUTION NMR
Deposited Date: 2008-06-25 Deposition Author(s): Acton, T.B. , Aramini, J.A. , Baran, M.C. , Hang, D. , Jiang, M. , Liu, J. , Maglaqui, M. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Rossi, P. , Rost, B. , Wang, D. , Xiao, R.