Nmr solution structure of a3dk08 protein from clostridium thermocellum: northeast structural genomics consortium target cmr9
PDB DOI: 10.2210/pdb2k53/pdb
Classification: structural genomics, unknown function Organism(s): Sulfolobus Solfataricus (Strain Atcc 35092 / Dsm 1617 / Jcm 11322 / P2)
Deposited: 2008-06-24 Deposition Author(s): Acton, T.B. , Everett, J. , Foote, E.L. , Huang, W. , Jiang, M. , Montelione, G.T. , Nair, R. , Northeast Structural Genomics Consortium (Nesg) , Rost, B. , Swapna, G.V.T. , Xiao, R.
Method: SOLUTION NMR Resolution: N.A.
Nmr solution structure of a3dk08 protein from clostridium thermocellum: northeast structural genomics consortium target cmr9
Acton, T.B. , Everett, J. , Foote, E.L. , Huang, W. , Jiang, M. , Montelione, G.T. , Nair, R. , Northeast Structural Genomics Consortium (Nesg) , Rost, B. , Swapna, G.V.T. , Xiao, R.
Primary Citation of Related Structures: 2K53
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
A3DK08 Protein | A | 76 | Sulfolobus Solfataricus (Strain Atcc 35092 / Dsm 1617 / Jcm 11322 / P2) | MKITKDMIIADVLQMDRGTAPIFINNGMHCLGCPSSMGESIEDACAVHGIDADKLVKELNEYFEKKEVLEHHHHHH |
Method: SOLUTION NMR
Deposited Date: 2008-06-24 Deposition Author(s): Acton, T.B. , Everett, J. , Foote, E.L. , Huang, W. , Jiang, M. , Montelione, G.T. , Nair, R. , Northeast Structural Genomics Consortium (Nesg) , Rost, B. , Swapna, G.V.T. , Xiao, R.