Solution structure of the scorpion toxin adwx-1
PDB DOI: 10.2210/pdb2k4u/pdb
Classification: TOXIN Organism(s): Human Coronavirus Nl63
Deposited: 2008-06-18 Deposition Author(s): Cao, Z.J. , Han, S. , Jiang, L. , Li, W.X. , Liu, H. , Liu, M.L. , Wu, Y.L. , Yang, D.W. , Yi, H. , Yin, S.J.
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Potassium channel toxin alpha-KTx 3.6 | A | 37 | Human Coronavirus Nl63 | VGINVKCKHSRQCLKPCKDAGMRFGKCTNGKCHCTPK |
Method: SOLUTION NMR