Solution structure of the gtpase binding domain of wasp in complex with espfu, an ehec effector
PDB DOI: 10.2210/pdb2k42/pdb
Classification: SIGNALING PROTEIN Organism(s): Escherichia Coli O157:H7 , Homo Sapiens
Deposited: 2008-05-27 Deposition Author(s): Campellone, K.G. , Cheng, H.-C. , Leong, J.M. , Rosen, M.K. , Skehan, B.M.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the gtpase binding domain of wasp in complex with espfu, an ehec effector
Campellone, K.G. , Cheng, H.-C. , Leong, J.M. , Rosen, M.K. , Skehan, B.M.
Primary Citation of Related Structures: 2K42
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Wiskott-Aldrich syndrome protein | A | 72 | Escherichia Coli O157:H7 , Homo Sapiens | GHMSGFKHVSHVGWDPQNGFDVNNLDPDLRSLFSRAGISEAQLTDAETSKLIYDFIEDQGGLEAVRQEMRRQ |
| ESPFU | B | 36 | Escherichia Coli O157:H7 , Homo Sapiens | GHMLPDVAQRLMQHLAEHGIQPARNMAEHIPPAPNW |
Method: SOLUTION NMR
Deposited Date: 2008-05-27 Deposition Author(s): Campellone, K.G. , Cheng, H.-C. , Leong, J.M. , Rosen, M.K. , Skehan, B.M.