2K3U
Structure of the tyrosine-sulfated c5a receptor n-terminus in complex with the immune evasion protein chips.
PDB DOI: 10.2210/pdb2k3u/pdb
Classification: IMMUNE SYSTEM Organism(s): Staphylococcus Aureus Subsp. Aureus Str. Newman , Synthetic Construct
Deposited: 2008-05-16 Deposition Author(s): Bunschoten, A. , Ippel, J.H. , Kemmink, J. , Liskamp, R.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Structure of the tyrosine-sulfated c5a receptor n-terminus in complex with the immune evasion protein chips.
Bunschoten, A. , Ippel, J.H. , Kemmink, J. , Liskamp, R.
Primary Citation of Related Structures: 2K3U
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Chemotaxis inhibitory protein | A | 91 | Staphylococcus Aureus Subsp. Aureus Str. Newman , Synthetic Construct | NSGLPTTLGKLDERLRNYLKKGTKNSAQFEKMVILTENKGYYTVYLNTPLAEDRKNVELLGKMYKTYFFKKGESKSSYVINGPGKTNEYAY |
| C5a anaphylatoxin chemotactic receptor 1 | B | 24 | Staphylococcus Aureus Subsp. Aureus Str. Newman , Synthetic Construct | XTTPDYGHYDDKDTLDLNTPVDKX |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2008-05-16 Deposition Author(s): Bunschoten, A. , Ippel, J.H. , Kemmink, J. , Liskamp, R.