Solution structure of the folded domain of intermediate iiia of tick carboxypeptidase inhibitor
PDB DOI: 10.2210/pdb2k2y/pdb
Classification: HYDROLASE INHIBITOR Organism(s): Rhipicephalus Bursa
Deposited: 2008-04-15 Deposition Author(s): Blanco, F. , Pantoja-Uceda, D.
Solution structure of the folded domain of intermediate iiia of tick carboxypeptidase inhibitor
Blanco, F. , Pantoja-Uceda, D.
Primary Citation of Related Structures: 2K2Y
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Carboxypeptidase inhibitor | A | 39 | Rhipicephalus Bursa | NECVSKGFGCLPQSDCPQEARLSYGGCSTVCCDLSKLTG |
Method: SOLUTION NMR
Deposited Date: 2008-04-15 Deposition Author(s): Blanco, F. , Pantoja-Uceda, D.