Nmr structure of the complex between tfb1 subunit of tfiih and the activation domain of vp16
PDB DOI: 10.2210/pdb2k2u/pdb
Classification: TRANSCRIPTION Organism(s): Human Herpesvirus 1 , Saccharomyces Cerevisiae
Deposited: 2008-04-11 Deposition Author(s): Di Lello, P. , Langlois, C. , Legault, J. , Mas, C. , Miller Jenkins, P.M. , Omichinski, J.G.
Nmr structure of the complex between tfb1 subunit of tfiih and the activation domain of vp16
Di Lello, P. , Langlois, C. , Legault, J. , Mas, C. , Miller Jenkins, P.M. , Omichinski, J.G.
Primary Citation of Related Structures: 2K2U
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| RNA polymerase II transcription factor B subunit 1 | A | 115 | Human Herpesvirus 1 , Saccharomyces Cerevisiae | PSHSGAAIFEKVSGIIAINEDVSPAELTWRSTDGDKVHTVVLSTIDKLQATPASSEKMMLRLIGKVDESKKRKDNEGNEVVPKPQRHMFSFNNRTVMDNIKMTLQQIISRYKDAD |
| Alpha trans-inducing protein | B | 35 | Human Herpesvirus 1 , Saccharomyces Cerevisiae | GFTPHDSAPYGALDMADFEFEQMFTDALGIDEYGG |
Method: SOLUTION NMR
Deposited Date: 2008-04-11 Deposition Author(s): Di Lello, P. , Langlois, C. , Legault, J. , Mas, C. , Miller Jenkins, P.M. , Omichinski, J.G.