2K2I
Nmr solution structure of the c-terminal domain (t94-y172) of the human centrin 2 in complex with a repeat sequence of human sfi1 (r641-t660)
PDB DOI: 10.2210/pdb2k2i/pdb
Classification: CELL CYCLE Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2008-04-02 Deposition Author(s): Assairi, L. , Blouquit, Y. , Craescu, C. , Duchambon, P. , Martinez-Sanz, J. , Mouawad, L.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Nmr solution structure of the c-terminal domain (t94-y172) of the human centrin 2 in complex with a repeat sequence of human sfi1 (r641-t660)
Assairi, L. , Blouquit, Y. , Craescu, C. , Duchambon, P. , Martinez-Sanz, J. , Mouawad, L.
Primary Citation of Related Structures: 2K2I
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Centrin-2 | A | 79 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | TQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY |
| SFI1 peptide | B | 20 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | RADLHHQHSVLHRALQAWVT |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2008-04-02 Deposition Author(s): Assairi, L. , Blouquit, Y. , Craescu, C. , Duchambon, P. , Martinez-Sanz, J. , Mouawad, L.