Solution structure of the second zinc finger domain of zranb2/znf265
PDB DOI: 10.2210/pdb2k1p/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens
Deposited: 2008-03-13 Deposition Author(s): Loughlin, F.E. , Mackay, J.P.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the second zinc finger domain of zranb2/znf265
Primary Citation of Related Structures: 2K1P
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Zinc finger Ran-binding domain-containing protein 2 | A | 33 | Homo Sapiens | GSSANDWQCKTCSNVNWARRSECNMCNTPKYAK |
Method: SOLUTION NMR
Deposited Date: 2008-03-13 Deposition Author(s): Loughlin, F.E. , Mackay, J.P.