Dna bound structure of the n-terminal domain of abrb
PDB DOI: 10.2210/pdb2k1n/pdb
Classification: TRANSCRIPTION/DNA Organism(s): Bacillus Subtilis , Synthetic Construct
Deposited: 2008-03-10 Deposition Author(s): Bobay, B.G. , Cavanagh, J. , Sullivan, D.M. , Thompson, R.J.
Dna bound structure of the n-terminal domain of abrb
Bobay, B.G. , Cavanagh, J. , Sullivan, D.M. , Thompson, R.J.
Primary Citation of Related Structures: 2K1N
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
AbrB family transcriptional regulator | A | 55 | Bacillus Subtilis , Synthetic Construct | MKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPNMTCQ |
AbrB family transcriptional regulator | B | 55 | Bacillus Subtilis , Synthetic Construct | MKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPNMTCQ |
AbrB family transcriptional regulator | C | 55 | Bacillus Subtilis , Synthetic Construct | MKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPNMTCQ |
AbrB family transcriptional regulator | D | 55 | Bacillus Subtilis , Synthetic Construct | MKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPNMTCQ |
Method: SOLUTION NMR
Deposited Date: 2008-03-10 Deposition Author(s): Bobay, B.G. , Cavanagh, J. , Sullivan, D.M. , Thompson, R.J.