Zinc-finger 2 of nup153
PDB DOI: 10.2210/pdb2k0c/pdb
Classification: METAL BINDING PROTEIN Organism(s): Rattus Norvegicus
Deposited: 2008-01-31 Deposition Author(s): Bangert, J.A. , Schrader, N. , Stoll, R. , Vetter, I.R.
Zinc-finger 2 of nup153
Bangert, J.A. , Schrader, N. , Stoll, R. , Vetter, I.R.
Primary Citation of Related Structures: 2K0C
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Nuclear pore complex protein Nup153 | A | 53 | Rattus Norvegicus | SDKPASTSGTGFGDKFKPAIGTWDCDTCLVQNKPEAVKCVACETPKPGTGVKR |
Method: SOLUTION NMR
Deposited Date: 2008-01-31 Deposition Author(s): Bangert, J.A. , Schrader, N. , Stoll, R. , Vetter, I.R.