Structure of sdf1 in complex with the cxcr4 n-terminus containing sulfotyrosines at postitions 7, 12 and 21
PDB DOI: 10.2210/pdb2k05/pdb
Classification: CYTOKINE Organism(s): Homo Sapiens
Deposited: 2008-01-24 Deposition Author(s): Peterson, F.C. , Veldkamp, C.T. , Volkman, B.F.
Structure of sdf1 in complex with the cxcr4 n-terminus containing sulfotyrosines at postitions 7, 12 and 21
Peterson, F.C. , Veldkamp, C.T. , Volkman, B.F.
Primary Citation of Related Structures: 2K05
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Stromal cell-derived factor 1 | A | 70 | Homo Sapiens | GMKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCACQIVARLKNNNRQVCIDPKLKWIQEYLEKCLNK |
| Stromal cell-derived factor 1 | C | 70 | Homo Sapiens | GMKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCACQIVARLKNNNRQVCIDPKLKWIQEYLEKCLNK |
| C-X-C chemokine receptor type 4 | B | 40 | Homo Sapiens | GSMEGISIYTSDNYTEEMGSGDYDSMKEPAFREENANFNK |
| C-X-C chemokine receptor type 4 | D | 40 | Homo Sapiens | GSMEGISIYTSDNYTEEMGSGDYDSMKEPAFREENANFNK |
Method: SOLUTION NMR
Deposited Date: 2008-01-24 Deposition Author(s): Peterson, F.C. , Veldkamp, C.T. , Volkman, B.F.