2K00
Solution structure of the talin f3 in complex with layilin cytodomain
PDB DOI: 10.2210/pdb2k00/pdb
Classification: STRUCTURAL PROTEIN Organism(s): Caldanaerobius , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2008-01-23 Deposition Author(s): Barsukov, I.L. , Wegener, K.L.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the talin f3 in complex with layilin cytodomain
Barsukov, I.L. , Wegener, K.L.
Primary Citation of Related Structures: 2K00
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Talin-1 | A | 92 | Caldanaerobius , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIIL |
| Layilin | B | 15 | Caldanaerobius , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GRSKESGWVENEIYY |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2008-01-23 Deposition Author(s): Barsukov, I.L. , Wegener, K.L.