Structure of iib domain of the mannose transporter of e. coli
PDB DOI: 10.2210/pdb2jzh/pdb
Classification: TRANSFERASE Organism(s): Escherichia Coli
Deposited: 2008-01-08 Deposition Author(s): Komlosh, M. , Williams Jr., D.C.
Method: SOLUTION NMR Resolution: N.A.
Structure of iib domain of the mannose transporter of e. coli
Komlosh, M. , Williams Jr., D.C.
Primary Citation of Related Structures: 2JZH
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| PTS system mannose-specific EIIAB component | A | 173 | Escherichia Coli | GSMKPMGPNDYMVIGLARIDDRLIHGQVATRWTKETNVSRIIVVSDEVAADTVRKTLLTQVAPPGVTAHVVDVAKMIRVYNNPKYAGERVMLLFTNPTDVERLVEGGVKITSVNVGGMAFRQGKTQVNNAVSVDEKDIEAFKKLNARGIELEVRKVSTDPKLKMMDLISKIDK |
Method: SOLUTION NMR
Deposited Date: 2008-01-08 Deposition Author(s): Komlosh, M. , Williams Jr., D.C.