Solution structure of c8a/c37a-t1 from nicotiana alata
PDB DOI: 10.2210/pdb2jyy/pdb
Classification: HYDROLASE INHIBITOR Organism(s): Nicotiana Alata
Deposited: 2007-12-20 Deposition Author(s): Anderson, M.A. , Craik, D.J. , Guarino, R.F. , Schirra, H.
Solution structure of c8a/c37a-t1 from nicotiana alata
Anderson, M.A. , Craik, D.J. , Guarino, R.F. , Schirra, H.
Primary Citation of Related Structures: 2JYY
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Proteinase inhibitor | A | 53 | Nicotiana Alata | DRICTNCAAGTKGCKYFSDDGTFVCEGESDPRNPKAAPRNCDPRIAYGICPLA |
Method: SOLUTION NMR
Deposited Date: 2007-12-20 Deposition Author(s): Anderson, M.A. , Craik, D.J. , Guarino, R.F. , Schirra, H.