Structure of the fifth zinc finger of myelin transcription factor 1
PDB DOI: 10.2210/pdb2jyd/pdb
Classification: METAL BINDING PROTEIN Organism(s): Enterobacter Aerogenes
Deposited: 2007-12-12 Deposition Author(s): Gamsjaeger, R. , Kobus, F.J. , Kwan, A.H. , Lehtomaki, E. , Lowry, J.A. , Mackay, J.P. , Matthews, J.M. , Swanton, M.K.
Structure of the fifth zinc finger of myelin transcription factor 1
Gamsjaeger, R. , Kobus, F.J. , Kwan, A.H. , Lehtomaki, E. , Lowry, J.A. , Mackay, J.P. , Matthews, J.M. , Swanton, M.K.
Primary Citation of Related Structures: 2JYD
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
F5 domain of Myelin transcription factor 1 | A | 46 | Enterobacter Aerogenes | GSMAAHSADLKCPTPGCDGSGHITGNYASHRSLSGCPRAKKSGLRV |
Method: SOLUTION NMR
Deposited Date: 2007-12-12 Deposition Author(s): Gamsjaeger, R. , Kobus, F.J. , Kwan, A.H. , Lehtomaki, E. , Lowry, J.A. , Mackay, J.P. , Matthews, J.M. , Swanton, M.K.