Solution structure of the dna binding domain of proline utilization a (puta)
PDB DOI: 10.2210/pdb2jxg/pdb
Classification: DNA BINDING PROTEIN Organism(s): Bacillus Sp. (Strain Hil-Y85/54728)
Deposited: 2007-11-19 Deposition Author(s): Becker, D. , Halouska, S. , Powers, R. , Zhou, Y.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the dna binding domain of proline utilization a (puta)
Becker, D. , Halouska, S. , Powers, R. , Zhou, Y.
Primary Citation of Related Structures: 2JXG
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Proline dehydrogenase | A | 45 | Bacillus Sp. (Strain Hil-Y85/54728) | MATTTLGVKLDDPTRERLKAAAQSIDRTPHWLIKQAIFNYLEKLE |
Proline dehydrogenase | B | 45 | Bacillus Sp. (Strain Hil-Y85/54728) | MATTTLGVKLDDPTRERLKAAAQSIDRTPHWLIKQAIFNYLEKLE |
Method: SOLUTION NMR
Deposited Date: 2007-11-19 Deposition Author(s): Becker, D. , Halouska, S. , Powers, R. , Zhou, Y.