Nmr structure of human serine protease inhibitor kazal type ii (spink2)
PDB DOI: 10.2210/pdb2jxd/pdb
Classification: HYDROLASE INHIBITOR Organism(s): Salmonella Enterica
Deposited: 2007-11-15 Deposition Author(s): Chen, T. , Lee, T.-R. , Lyu, P.-C.
Nmr structure of human serine protease inhibitor kazal type ii (spink2)
Chen, T. , Lee, T.-R. , Lyu, P.-C.
Primary Citation of Related Structures: 2JXD
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Serine protease inhibitor Kazal-type 2 | A | 62 | Salmonella Enterica | PQFGLFSKYRTPNCSQYRLPGCPRHFNPVCGSDMSTYANECTLCMKIREGGHNIKIIRNGPC |
Method: SOLUTION NMR
Deposited Date: 2007-11-15 Deposition Author(s): Chen, T. , Lee, T.-R. , Lyu, P.-C.