2JX8
Solution structure of hpcif1 ww domain
PDB DOI: 10.2210/pdb2jx8/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens
Deposited: 2007-11-09 Deposition Author(s): Aizawa, T. , Demura, M. , Hirose, Y. , Iwamoto, Y. , Kawano, K. , Kouno, T. , Mizuguchi, M. , Ohkuma, Y.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution structure of hpcif1 ww domain
Aizawa, T. , Demura, M. , Hirose, Y. , Iwamoto, Y. , Kawano, K. , Kouno, T. , Mizuguchi, M. , Ohkuma, Y.
Primary Citation of Related Structures: 2JX8
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Phosphorylated CTD-interacting factor 1 | A | 52 | Homo Sapiens | GPLGSLPEELVHAGWEKCWSRRENRPYYFNRFTNQSLWEMPVLGQHDVISDP |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2007-11-09 Deposition Author(s): Aizawa, T. , Demura, M. , Hirose, Y. , Iwamoto, Y. , Kawano, K. , Kouno, T. , Mizuguchi, M. , Ohkuma, Y.