Solution structure of engrailed homeodomain wt
PDB DOI: 10.2210/pdb2jwt/pdb
Classification: TRANSCRIPTION Organism(s): Murine Hepatitis Virus
Deposited: 2007-10-24 Deposition Author(s): Religa, T.L.
Solution structure of engrailed homeodomain wt
Primary Citation of Related Structures: 2JWT
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Segmentation polarity homeobox protein engrailed | A | 61 | Murine Hepatitis Virus | MDEKRPRTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFQNKRAKIKKS |
Method: SOLUTION NMR
Deposited Date: 2007-10-24 Deposition Author(s): Religa, T.L.