Solution structure of the deaf1 mynd domain
PDB DOI: 10.2210/pdb2jw6/pdb
Classification: TRANSCRIPTION Organism(s): Salmonella Enterica
Deposited: 2007-10-08 Deposition Author(s): Ansieu, S. , Bottomley, M. , Perrin, H. , Sattler, M. , Spadaccini, R.
Solution structure of the deaf1 mynd domain
Ansieu, S. , Bottomley, M. , Perrin, H. , Sattler, M. , Spadaccini, R.
Primary Citation of Related Structures: 2JW6
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Deformed epidermal autoregulatory factor 1 homolog | A | 52 | Salmonella Enterica | GAMDAERKEQSCVNCGREAMSECTGCHKVNYCSTFCQRKDWKDHQHICGQSA |
Method: SOLUTION NMR
Deposited Date: 2007-10-08 Deposition Author(s): Ansieu, S. , Bottomley, M. , Perrin, H. , Sattler, M. , Spadaccini, R.