2JW1
Structural characterization of the type iii pilotin-secretin interaction in shigella flexneri by nmr spectroscopy
PDB DOI: 10.2210/pdb2jw1/pdb
Classification: MEMBRANE PROTEIN Organism(s): Sulfurovum , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2007-10-02 Deposition Author(s): Creagh, L. , Jung, Y.M.T. , Lario, P.I. , Maurelli, A.T. , Mcintosh, L.P. , Okon, M.S. , Strynadka, N.C.J.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Structural characterization of the type iii pilotin-secretin interaction in shigella flexneri by nmr spectroscopy
Creagh, L. , Jung, Y.M.T. , Lario, P.I. , Maurelli, A.T. , Mcintosh, L.P. , Okon, M.S. , Strynadka, N.C.J.
Primary Citation of Related Structures: 2JW1
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Lipoprotein mxiM | A | 115 | Sulfurovum , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SSSNSEKEWHIVPVSKDYFSIPNDLLWSFNTTNKSINVYSKCISGKAVYSFNAGKFMGNFNVKEVDGCFMDAQKIAIDKLFSMLKDGVVLKGNKINDTILIEKDGEVKLKLIRGI |
| Outer membrane protein mxiD | B | 19 | Sulfurovum , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | XSETTLLEDEKSLVSYLNY |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2007-10-02 Deposition Author(s): Creagh, L. , Jung, Y.M.T. , Lario, P.I. , Maurelli, A.T. , Mcintosh, L.P. , Okon, M.S. , Strynadka, N.C.J.