Solution nmr structure of the folded n-terminal fragment of upf0291 protein ynzc from bacillus subtilis. northeast structural genomics target sr384-1-46
PDB DOI: 10.2210/pdb2jvd/pdb
Classification: STRUCTURAL GENOMICS, UNKNOWN FUNCTION Organism(s): Tomato Spotted Wilt Virus (Strain Bulgarian L3)
Deposited: 2007-09-18 Deposition Author(s): Acton, T.B. , Aramini, J.M. , Baran, M.C. , Huang, Y.J. , Jiang, M. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Owens, L.A. , Sharma, S. , Stokes, K. , Swapna, G.V.T. , Xiao, R. , Zhao, L.
Solution nmr structure of the folded n-terminal fragment of upf0291 protein ynzc from bacillus subtilis. northeast structural genomics target sr384-1-46
Acton, T.B. , Aramini, J.M. , Baran, M.C. , Huang, Y.J. , Jiang, M. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Owens, L.A. , Sharma, S. , Stokes, K. , Swapna, G.V.T. , Xiao, R. , Zhao, L.
Primary Citation of Related Structures: 2JVD
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
UPF0291 protein ynzC | A | 54 | Tomato Spotted Wilt Virus (Strain Bulgarian L3) | MISNAKIARINELAAKAKAGVITEEEKAEQQKLRQEYLKGFRSSMKLEHHHHHH |
Method: SOLUTION NMR
Deposited Date: 2007-09-18 Deposition Author(s): Acton, T.B. , Aramini, J.M. , Baran, M.C. , Huang, Y.J. , Jiang, M. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Owens, L.A. , Sharma, S. , Stokes, K. , Swapna, G.V.T. , Xiao, R. , Zhao, L.