Structure characterisation of pina ww domain and comparison with other group iv ww domains, pin1 and ess1
PDB DOI: 10.2210/pdb2jv4/pdb
Classification: ISOMERASE Organism(s): Emericella Nidulans
Deposited: 2007-09-11 Deposition Author(s): Brownlee, R.T.C. , Kato, Y. , Ng, C.A. , Tanokura, M.
Structure characterisation of pina ww domain and comparison with other group iv ww domains, pin1 and ess1
Brownlee, R.T.C. , Kato, Y. , Ng, C.A. , Tanokura, M.
Primary Citation of Related Structures: 2JV4
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Peptidyl-prolyl cis/trans isomerase | A | 54 | Emericella Nidulans | GSMVNTGLPAGWEVRHSNSKNLPYYFNPATRESRWEPPADTDMETLKMYMATYH |
Method: SOLUTION NMR
Deposited Date: 2007-09-11 Deposition Author(s): Brownlee, R.T.C. , Kato, Y. , Ng, C.A. , Tanokura, M.