2JU4
Nmr structure of the gamma subunit of cgmp phosphodiesterase
PDB DOI: 10.2210/pdb2ju4/pdb
Classification: HYDROLASE Organism(s): Bos Taurus
Deposited: 2007-08-14 Deposition Author(s): Center For Eukaryotic Structural Genomics (Cesg) , Guo, L.W. , Markley, J.L. , Ruoho, A.E. , Song, J.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Nmr structure of the gamma subunit of cgmp phosphodiesterase
Center For Eukaryotic Structural Genomics (Cesg) , Guo, L.W. , Markley, J.L. , Ruoho, A.E. , Song, J.
Primary Citation of Related Structures: 2JU4
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit gamma | A | 87 | Bos Taurus | MNLEPPKAECRSATRVMGGPCTPRKGPPKCKQRQTRQCKSKPPKKGVQGCGDDIPGMEGCGTDITVICPWEACNHCELHELAQYGIC |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2007-08-14 Deposition Author(s): Center For Eukaryotic Structural Genomics (Cesg) , Guo, L.W. , Markley, J.L. , Ruoho, A.E. , Song, J.