Solution structure of the human pirh2 ring-h2 domain. northeast structural genomics consortium target ht2b
PDB DOI: 10.2210/pdb2jrj/pdb
Classification: LIGASE Organism(s): Homo Sapiens
Deposited: 2007-06-27 Deposition Author(s): Arrowsmith, C.H. , Laister, R.C. , Lemak, A. , Northeast Structural Genomics Consortium (Nesg) , Sheng, Y. , Wu, B.
Solution structure of the human pirh2 ring-h2 domain. northeast structural genomics consortium target ht2b
Arrowsmith, C.H. , Laister, R.C. , Lemak, A. , Northeast Structural Genomics Consortium (Nesg) , Sheng, Y. , Wu, B.
Primary Citation of Related Structures: 2JRJ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Ring finger and CHY zinc finger domain containing protein 1 | A | 52 | Homo Sapiens | ENVSQQNCPICLEDIHTSRVVAHVLPCGHLLHRTCYEEMLKEGYRCPLCMHS |
Method: SOLUTION NMR
Deposited Date: 2007-06-27 Deposition Author(s): Arrowsmith, C.H. , Laister, R.C. , Lemak, A. , Northeast Structural Genomics Consortium (Nesg) , Sheng, Y. , Wu, B.