Solution structure of manduca sexta moricin
PDB DOI: 10.2210/pdb2jr8/pdb
Classification: ANTIMICROBIAL PROTEIN Organism(s): N.A.
Deposited: 2007-06-21 Deposition Author(s): Dai, H. , Gong, Y. , Huang, R. , Jiang, H. , Prakash, O. , Rayaprolu, S.
Solution structure of manduca sexta moricin
Dai, H. , Gong, Y. , Huang, R. , Jiang, H. , Prakash, O. , Rayaprolu, S.
Primary Citation of Related Structures: 2JR8
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Antimicrobial peptide moricin | A | 42 | N.A. | GKIPVKAIKQAGKVIGKGLRAINIAGTTHDVVSFFRPKKKKH |
Method: SOLUTION NMR
Deposited Date: 2007-06-21 Deposition Author(s): Dai, H. , Gong, Y. , Huang, R. , Jiang, H. , Prakash, O. , Rayaprolu, S.