Joint refinement of the hiv-1 ca-ntd in complex with the assembly inhibitor cap-1
PDB DOI: 10.2210/pdb2jpr/pdb
Classification: VIRAL PROTEIN Organism(s): Human Immunodeficiency Virus Type 1 (New York-5 Isolate)
Deposited: 2007-05-22 Deposition Author(s): Hill, C.P. , Howard, B.R. , Kelly, B.N. , Kinde, I. , Kyere, S. , Robinson, H. , Summers, M.F. , Sundquist, W.I. , Tang, C.
Joint refinement of the hiv-1 ca-ntd in complex with the assembly inhibitor cap-1
Hill, C.P. , Howard, B.R. , Kelly, B.N. , Kinde, I. , Kyere, S. , Robinson, H. , Summers, M.F. , Sundquist, W.I. , Tang, C.
Primary Citation of Related Structures: 2JPR
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Gag-Pol polyprotein | A | 145 | Human Immunodeficiency Virus Type 1 (New York-5 Isolate) | PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMY |
Method: SOLUTION NMR
Deposited Date: 2007-05-22 Deposition Author(s): Hill, C.P. , Howard, B.R. , Kelly, B.N. , Kinde, I. , Kyere, S. , Robinson, H. , Summers, M.F. , Sundquist, W.I. , Tang, C.