Nmr structure of mini-b, an n-terminal- c-terminal construct from human surfactant protein-b (sp-b), in hexafluoroisopropanol (hfip)
PDB DOI: 10.2210/pdb2jou/pdb
Classification: SURFACE ACTIVE PROTEIN Organism(s): N.A.
Deposited: 2007-03-26 Deposition Author(s): Booth, V. , Keough, K.M.W. , Sarker, M. , Walther, F.J. , Waring, A.J.
Method: SOLUTION NMR Resolution: N.A.
Nmr structure of mini-b, an n-terminal- c-terminal construct from human surfactant protein-b (sp-b), in hexafluoroisopropanol (hfip)
Booth, V. , Keough, K.M.W. , Sarker, M. , Walther, F.J. , Waring, A.J.
Primary Citation of Related Structures: 2JOU
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Pulmonary surfactant-associated protein B | A | 34 | N.A. | CWLCRALIKRIQAMIPKGGRMLPQLVCRLVLRCS |
Method: SOLUTION NMR
Deposited Date: 2007-03-26 Deposition Author(s): Booth, V. , Keough, K.M.W. , Sarker, M. , Walther, F.J. , Waring, A.J.