2JO8
Solution structure of c-terminal domain of human mammalian sterile 20-like kinase 1 (mst1)
PDB DOI: 10.2210/pdb2jo8/pdb
Classification: TRANSFERASE Organism(s): Homo Sapiens
Deposited: 2007-02-26 Deposition Author(s): Cheong, C. , Cheong, H.-K. , Guntert, P. , Hwang, E. , Jeon, Y.H. , Lee, J.O. , Lim, D.-S. , Paakkonen, K. , Ryu, K.-S.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution structure of c-terminal domain of human mammalian sterile 20-like kinase 1 (mst1)
Cheong, C. , Cheong, H.-K. , Guntert, P. , Hwang, E. , Jeon, Y.H. , Lee, J.O. , Lim, D.-S. , Paakkonen, K. , Ryu, K.-S.
Primary Citation of Related Structures: 2JO8
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Serine/threonine-protein kinase 4 | A | 51 | Homo Sapiens | GSDYEFLKSWTVEDLQKRLLALDPMMEQEIEEIRQKYQSKRQPILDAIEAK |
| Serine/threonine-protein kinase 4 | B | 51 | Homo Sapiens | GSDYEFLKSWTVEDLQKRLLALDPMMEQEIEEIRQKYQSKRQPILDAIEAK |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2007-02-26 Deposition Author(s): Cheong, C. , Cheong, H.-K. , Guntert, P. , Hwang, E. , Jeon, Y.H. , Lee, J.O. , Lim, D.-S. , Paakkonen, K. , Ryu, K.-S.