3d nmr structure of ecd1 of mcrf-r2b in complex with astressin
PDB DOI: 10.2210/pdb2jnd/pdb
Classification: LIGAND BINDING PROTEIN Organism(s): Mus Musculus , Synthetic Construct
Deposited: 2007-01-08 Deposition Author(s): Cantle, J.P. , Digruccio, M.R. , Grace, C.R.R. , Jozsef, G. , Perrin, M.H. , Riek, R. , Rivier, J.E. , Vale, W.W.
3d nmr structure of ecd1 of mcrf-r2b in complex with astressin
Cantle, J.P. , Digruccio, M.R. , Grace, C.R.R. , Jozsef, G. , Perrin, M.H. , Riek, R. , Rivier, J.E. , Vale, W.W.
Primary Citation of Related Structures: 2JND
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Corticotropin-releasing factor receptor 2 | A | 119 | Mus Musculus , Synthetic Construct | GSGMKETAAAKFERQHMDSPDLGTTLLEQYCHRTTIGNFSGPYTYCNTTLDQIGTCWPQSAPGALVERPCPEYFNGIKYNTTRNAYRECLENGTWASRVNYSHCEPILDDKQRKYDLHY |
| ASTRESSIN | B | 31 | Mus Musculus , Synthetic Construct | FHLLREVLELARAEQLAQEAHKNRKLLEIIX |
Method: SOLUTION NMR
Deposited Date: 2007-01-08 Deposition Author(s): Cantle, J.P. , Digruccio, M.R. , Grace, C.R.R. , Jozsef, G. , Perrin, M.H. , Riek, R. , Rivier, J.E. , Vale, W.W.