2JMJ
Nmr solution structure of the phd domain from the yeast yng1 protein in complex with h3(1-9)k4me3 peptide
PDB DOI: 10.2210/pdb2jmj/pdb
Classification: PROTEIN BINDING Organism(s): Grouper Iridovirus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2006-11-15 Deposition Author(s): Aitchison, J.D. , Allis, C.D. , Baker, L. , Blair, L.P. , Boyle, J. , Chait, B.T. , Ilin, S. , Lavender, H. , Li, H. , Patel, D.J. , Rogers, R.S. , Tackett, A.J. , Tanny, J.C. , Taverna, S.D.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Nmr solution structure of the phd domain from the yeast yng1 protein in complex with h3(1-9)k4me3 peptide
Aitchison, J.D. , Allis, C.D. , Baker, L. , Blair, L.P. , Boyle, J. , Chait, B.T. , Ilin, S. , Lavender, H. , Li, H. , Patel, D.J. , Rogers, R.S. , Tackett, A.J. , Tanny, J.C. , Taverna, S.D.
Primary Citation of Related Structures: 2JMJ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Protein YNG1 | A | 90 | Grouper Iridovirus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GPLGSHMASEFINQGDVTEGNNNQEEVYCFCRNVSYGPMVACDNPACPFEWFHYGCVGLKQAPKGKWYCSKDCKEIANQRSKSKRQKRRK |
| Histone H3 | P | 9 | Grouper Iridovirus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | ARTKQTARK |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2006-11-15 Deposition Author(s): Aitchison, J.D. , Allis, C.D. , Baker, L. , Blair, L.P. , Boyle, J. , Chait, B.T. , Ilin, S. , Lavender, H. , Li, H. , Patel, D.J. , Rogers, R.S. , Tackett, A.J. , Tanny, J.C. , Taverna, S.D.