Solution structure of the su(dx) ww4- notch py peptide complex
PDB DOI: 10.2210/pdb2jmf/pdb
Classification: Ligase/Signaling Protein Organism(s): Drosophila Melanogaster
Deposited: 2006-11-05 Deposition Author(s): Avis, J.M. , Blankley, R.T. , Golovanov, A.P. , Jennings, M.D.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the su(dx) ww4- notch py peptide complex
Avis, J.M. , Blankley, R.T. , Golovanov, A.P. , Jennings, M.D.
Primary Citation of Related Structures: 2JMF
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| E3 ubiquitin-protein ligase suppressor of deltex | A | 53 | Drosophila Melanogaster | GPLGSPEFHMVSLINEGPLPPGWEIRYTAAGERFFVDHNTRRTTFEDPRPGAP |
| Neurogenic locus Notch protein | B | 21 | Drosophila Melanogaster | GPLGSPNTGAKQPPSYEDCIK |
Method: SOLUTION NMR
Deposited Date: 2006-11-05 Deposition Author(s): Avis, J.M. , Blankley, R.T. , Golovanov, A.P. , Jennings, M.D.