The crystal structure of bak1 - a mitochondrial apoptosis regulator
PDB DOI: 10.2210/pdb2jcn/pdb
Classification: APOPTOSIS Organism(s): Homo Sapiens
Deposited: 2006-12-27 Deposition Author(s): Arrowsmith, C. , Berglund, H. , Busam, R. , Collins, R. , Edwards, A. , Ericsson, U.B. , Flodin, S. , Flores, A. , Graslund, S. , Hallberg, B.M. , Hammarstrom, M. , Holmberg Schiavone, L. , Johansson, I. , Karlberg, T. , Kosinska, U. , Kotenyova, T. , Lundgren, S. , Moche, M. , Nilsson, M.E. , Nordlund, P. , Nyman, T. , Ogg, D. , Persson, C. , Sagemark, J. , Stenmark, P. , Structural Genomics Consortium (Sgc) , Sundstrom, M. , Thorsell, A.G. , Uppenberg, J. , Upsten, M. , Van Den Berg, S. , Weigelt, J.
Method: X-RAY DIFFRACTION Resolution: 1.8 Å
The crystal structure of bak1 - a mitochondrial apoptosis regulator
Arrowsmith, C. , Berglund, H. , Busam, R. , Collins, R. , Edwards, A. , Ericsson, U.B. , Flodin, S. , Flores, A. , Graslund, S. , Hallberg, B.M. , Hammarstrom, M. , Holmberg Schiavone, L. , Johansson, I. , Karlberg, T. , Kosinska, U. , Kotenyova, T. , Lundgren, S. , Moche, M. , Nilsson, M.E. , Nordlund, P. , Nyman, T. , Ogg, D. , Persson, C. , Sagemark, J. , Stenmark, P. , Structural Genomics Consortium (Sgc) , Sundstrom, M. , Thorsell, A.G. , Uppenberg, J. , Upsten, M. , Van Den Berg, S. , Weigelt, J.
Primary Citation of Related Structures: 2JCN
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| BCL-2 HOMOLOGOUS ANTAGONIST/KILLER | A | 172 | Homo Sapiens | SMSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNGPILN |
Method: X-RAY DIFFRACTION
Deposited Date: 2006-12-27 Deposition Author(s): Arrowsmith, C. , Berglund, H. , Busam, R. , Collins, R. , Edwards, A. , Ericsson, U.B. , Flodin, S. , Flores, A. , Graslund, S. , Hallberg, B.M. , Hammarstrom, M. , Holmberg Schiavone, L. , Johansson, I. , Karlberg, T. , Kosinska, U. , Kotenyova, T. , Lundgren, S. , Moche, M. , Nilsson, M.E. , Nordlund, P. , Nyman, T. , Ogg, D. , Persson, C. , Sagemark, J. , Stenmark, P. , Structural Genomics Consortium (Sgc) , Sundstrom, M. , Thorsell, A.G. , Uppenberg, J. , Upsten, M. , Van Den Berg, S. , Weigelt, J.