Structure of the poz domain of human lrf, a master regulator of oncogenesis
PDB DOI: 10.2210/pdb2if5/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens
Deposited: 2006-09-20 Deposition Author(s): Schubot, F.D. , Tropea, J. , Waugh, D.S.
Structure of the poz domain of human lrf, a master regulator of oncogenesis
Schubot, F.D. , Tropea, J. , Waugh, D.S.
Primary Citation of Related Structures: 2IF5
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Zinc finger and BTB domain-containing protein 7A | A | 120 | Homo Sapiens | IGIPFPDHSSDILSGLNEQRTQGLLCDVVILVEGREFPTHRSVLAACSQYFKKLFTSGAVVDQQNVYEIDFVSAEALTALMDFAYTATLTVSTANVGDILSAARLLEIPAVSHVCADLLD |
Method: X-RAY DIFFRACTION
Deposited Date: 2006-09-20 Deposition Author(s): Schubot, F.D. , Tropea, J. , Waugh, D.S.