Solution structure of the ubiquitin-binding zinc finger (ubz) domain of the human dna y-polymerase eta
PDB DOI: 10.2210/pdb2i5o/pdb
Classification: TRANSFERASE Organism(s): Salmonella Enterica
Deposited: 2006-08-25 Deposition Author(s): Bomar, M.G. , Zhou, P.
Solution structure of the ubiquitin-binding zinc finger (ubz) domain of the human dna y-polymerase eta
Primary Citation of Related Structures: 2I5O
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
DNA polymerase eta | A | 39 | Salmonella Enterica | GSHMAAEDQVPCEKCGSLVPVWDMPEHMDYHFALELQKS |
Method: SOLUTION NMR
Deposited Date: 2006-08-25 Deposition Author(s): Bomar, M.G. , Zhou, P.