Solution structure of the rrm of srp20 bound to the rna cauc
PDB DOI: 10.2210/pdb2i2y/pdb
Classification: RNA binding protein/Chimera/RNA Organism(s): Streptococcus Sp. 'Group G', Homo Sapiens , Synthetic Construct
Deposited: 2006-08-17 Deposition Author(s): Allain, F.H. , Hargous, Y.F.
Solution structure of the rrm of srp20 bound to the rna cauc
Primary Citation of Related Structures: 2I2Y
| Nucleic Acids / Hybrid | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| (5'-R(*CP*AP*UP*C)-3') | b | 4 | NA | CAUC |
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Fusion protein consists of immunoglobulin G-Binding Protein G and Splicing factor, arginine/serine-rich 3 | A | 150 | Streptococcus Sp. 'Group G', Homo Sapiens , Synthetic Construct | MQYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEGSHHHHHHMHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEKR |
Method: SOLUTION NMR
Deposited Date: 2006-08-17 Deposition Author(s): Allain, F.H. , Hargous, Y.F.