Solution structure of the twelfth cysteine-rich ligand-binding repeat in rat megalin
PDB DOI: 10.2210/pdb2i1p/pdb
Classification: LIGAND BINDING PROTEIN Organism(s): Pandinus Imperator
Deposited: 2006-08-14 Deposition Author(s): Bade-Noskova, V. , Dancea, F. , Kerjaschki, D. , Luecke, C. , Rueterjans, H. , Shi, M. , Wolf, C.A.
Solution structure of the twelfth cysteine-rich ligand-binding repeat in rat megalin
Bade-Noskova, V. , Dancea, F. , Kerjaschki, D. , Luecke, C. , Rueterjans, H. , Shi, M. , Wolf, C.A.
Primary Citation of Related Structures: 2I1P
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Low-density lipoprotein receptor-related protein 2 | A | 48 | Pandinus Imperator | GAMVLNCTSAQFKCADGSSCINSRYRCDGVYDCRDNSDEAGCPTRPPG |
Method: SOLUTION NMR
Deposited Date: 2006-08-14 Deposition Author(s): Bade-Noskova, V. , Dancea, F. , Kerjaschki, D. , Luecke, C. , Rueterjans, H. , Shi, M. , Wolf, C.A.