2I0L
X-ray crystal structure of sap97 pdz2 bound to the c-terminal peptide of hpv18 e6.
PDB DOI: 10.2210/pdb2i0l/pdb
Classification: PEPTIDE BINDING PROTEIN Organism(s): Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2006-08-10 Deposition Author(s): Banks, L. , Chen, X.S. , Dasgupta, J. , Thomas, M. , Zhang, Y.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 2.31 Å
X-ray crystal structure of sap97 pdz2 bound to the c-terminal peptide of hpv18 e6.
Banks, L. , Chen, X.S. , Dasgupta, J. , Thomas, M. , Zhang, Y.
Primary Citation of Related Structures: 2I0L
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Disks large homolog 1 | A | 84 | Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | EIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKA |
| Disks large homolog 1 | B | 84 | Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | EIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKA |
| peptide E6 | C | 7 | Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | RRRETQV |
| peptide E6 | D | 7 | Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | RRRETQV |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2006-08-10 Deposition Author(s): Banks, L. , Chen, X.S. , Dasgupta, J. , Thomas, M. , Zhang, Y.