X-ray crystal structure of magi-1 pdz1 bound to the c-terminal peptide of hpv18 e6
PDB DOI: 10.2210/pdb2i04/pdb
Classification: PEPTIDE BINDING PROTEIN Organism(s): Mus Musculus , Synthetic Construct
Deposited: 2006-08-09 Deposition Author(s): Banks, L. , Chen, X.S. , Dasgupta, J. , Thomas, M. , Zhang, Y.
Method: X-RAY DIFFRACTION Resolution: 2.15 Å
X-ray crystal structure of magi-1 pdz1 bound to the c-terminal peptide of hpv18 e6
Banks, L. , Chen, X.S. , Dasgupta, J. , Thomas, M. , Zhang, Y.
Primary Citation of Related Structures: 2I04
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 | A | 85 | Mus Musculus , Synthetic Construct | SIHTKLRKSSRGFGFTVVGGDEPDEFLQIKSLVLDGPAALDGKMETGDVIVSVNDTCVLGHTHAQVVKIFQSIPIGASVDLELCR |
| Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 | B | 85 | Mus Musculus , Synthetic Construct | SIHTKLRKSSRGFGFTVVGGDEPDEFLQIKSLVLDGPAALDGKMETGDVIVSVNDTCVLGHTHAQVVKIFQSIPIGASVDLELCR |
| peptide E6 | C | 7 | Mus Musculus , Synthetic Construct | RRRETQV |
| peptide E6 | D | 7 | Mus Musculus , Synthetic Construct | RRRETQV |
Method: X-RAY DIFFRACTION
Deposited Date: 2006-08-09 Deposition Author(s): Banks, L. , Chen, X.S. , Dasgupta, J. , Thomas, M. , Zhang, Y.