Discovery of potent, orally active, nonpeptide inhibitors of human mast cell chymase by using structure-based drug design
PDB DOI: 10.2210/pdb2hvx/pdb
Classification: HYDROLASE Organism(s): Homo Sapiens
Deposited: 2006-07-31 Deposition Author(s): Almond, H.R. , Cantwell, A.M. , Damiano, B.P. , De Garavilla, L. , Di Cera, E. , Greco, M.N. , Hawkins, M.J. , Maryanoff, B.E. , Minor, L.A. , Powell, E.T. , Savvides, S.N. , Wang, Y. , Wells, G.I.
Method: X-RAY DIFFRACTION Resolution: 2.6 Å
Discovery of potent, orally active, nonpeptide inhibitors of human mast cell chymase by using structure-based drug design
Almond, H.R. , Cantwell, A.M. , Damiano, B.P. , De Garavilla, L. , Di Cera, E. , Greco, M.N. , Hawkins, M.J. , Maryanoff, B.E. , Minor, L.A. , Powell, E.T. , Savvides, S.N. , Wang, Y. , Wells, G.I.
Primary Citation of Related Structures: 2HVX
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Chymase | A | 226 | Homo Sapiens | IIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQKNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGAAQGIVSYGRSDAKPPAVFTRISHYQPWINQILQAN |
Method: X-RAY DIFFRACTION
Deposited Date: 2006-07-31 Deposition Author(s): Almond, H.R. , Cantwell, A.M. , Damiano, B.P. , De Garavilla, L. , Di Cera, E. , Greco, M.N. , Hawkins, M.J. , Maryanoff, B.E. , Minor, L.A. , Powell, E.T. , Savvides, S.N. , Wang, Y. , Wells, G.I.