3d solution structure of the chromo-2 domain of cpsrp43 complexed with cpsrp54 peptide
PDB DOI: 10.2210/pdb2hug/pdb
Classification: PLANT PROTEIN Organism(s): Arabidopsis Thaliana
Deposited: 2006-07-26 Deposition Author(s): Henry, R. , Kathir, K.M. , Thallapuranam, S.K.K. , Vaithiyalingam, S.
3d solution structure of the chromo-2 domain of cpsrp43 complexed with cpsrp54 peptide
Henry, R. , Kathir, K.M. , Thallapuranam, S.K.K. , Vaithiyalingam, S.
Primary Citation of Related Structures: 2HUG
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Signal recognition particle 43 kDa protein, chloroplast | A | 57 | Arabidopsis Thaliana | GSQVFEYAEVDEIVEKRGKGKDVEYLVRWKDGGDCEWVKGVHVAEDVAKDYEDGLEY |
Signal recognition particle 54 kDa protein, chloroplast | B | 14 | Arabidopsis Thaliana | APPGTARRKRKADS |
Method: SOLUTION NMR
Deposited Date: 2006-07-26 Deposition Author(s): Henry, R. , Kathir, K.M. , Thallapuranam, S.K.K. , Vaithiyalingam, S.