Solution structure of human p8-mtcp1, a cysteine-rich protein encoded by the mtcp1 oncogene,reveals a new alpha-helical assembly motif, nmr, 30 structures
PDB DOI: 10.2210/pdb2hp8/pdb
Classification: CYSTEINE MOTIF Organism(s): Homo Sapiens
Deposited: 1997-08-26 Deposition Author(s): Barthe, P. , Chiche, L. , Roumestand, C. , Strub, M.P.
Solution structure of human p8-mtcp1, a cysteine-rich protein encoded by the mtcp1 oncogene,reveals a new alpha-helical assembly motif, nmr, 30 structures
Barthe, P. , Chiche, L. , Roumestand, C. , Strub, M.P.
Primary Citation of Related Structures: 2HP8
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Cx9C motif-containing protein 4 | A | 79 | Homo Sapiens | GSPGIHMPQKDPCQKQACEIQKCLQANSYMESKCQAVIQELRKCCAQYPKGRSVVCSGFEKEEEENLTRKSASKGIHRD |
Method: SOLUTION NMR
Deposited Date: 1997-08-26 Deposition Author(s): Barthe, P. , Chiche, L. , Roumestand, C. , Strub, M.P.