Phage-selected homeodomain bound to unmodified dna
PDB DOI: 10.2210/pdb2hos/pdb
Classification: Transcription/DNA Organism(s): Murine Hepatitis Virus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2006-07-16 Deposition Author(s): Feldman, M.E. , Shokat, K.M. , Simon, M.D.
Phage-selected homeodomain bound to unmodified dna
Feldman, M.E. , Shokat, K.M. , Simon, M.D.
Primary Citation of Related Structures: 2HOS
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Segmentation polarity homeobox protein engrailed | A | 63 | Murine Hepatitis Virus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSDEKRPRTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQVKGWFKNMRAKIKKST |
Segmentation polarity homeobox protein engrailed | B | 63 | Murine Hepatitis Virus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSDEKRPRTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQVKGWFKNMRAKIKKST |
Method: X-RAY DIFFRACTION
Deposited Date: 2006-07-16 Deposition Author(s): Feldman, M.E. , Shokat, K.M. , Simon, M.D.