Nmr solution structure of a new tomato peptide
PDB DOI: 10.2210/pdb2hlg/pdb
Classification: PLANT PROTEIN Organism(s): Lycopersicon Esculentum
Deposited: 2006-07-07 Deposition Author(s): Barbero, J.J. , Mendez, B.L. , Uribe, M.I.C. , Vicinay, F.J.C.
Method: SOLUTION NMR Resolution: N.A.
Nmr solution structure of a new tomato peptide
Barbero, J.J. , Mendez, B.L. , Uribe, M.I.C. , Vicinay, F.J.C.
Primary Citation of Related Structures: 2HLG
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Fruit-specific protein | A | 39 | Lycopersicon Esculentum | LCNEPCSSNSDCIGITLCQFCKEKTDQYGLTYRTCNLLP |
Method: SOLUTION NMR
Deposited Date: 2006-07-07 Deposition Author(s): Barbero, J.J. , Mendez, B.L. , Uribe, M.I.C. , Vicinay, F.J.C.