Crystal structure of tthb049 from thermus thermophilus hb8
PDB DOI: 10.2210/pdb2hia/pdb
Classification: STRUCTURAL GENOMICS, UNKNOWN FUNCTION Organism(s): Thermus Thermophilus
Deposited: 2006-06-29 Deposition Author(s): Kunishima, N. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Sugahara, M.
Crystal structure of tthb049 from thermus thermophilus hb8
Kunishima, N. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Sugahara, M.
Primary Citation of Related Structures: 2HIA
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Alpha-ribazole-5'-phosphate phosphatase | A | 177 | Thermus Thermophilus | MELWLVRHGETLWNREGRLLGWTDLPLTAEGEAQARRLKGALPSLPAFSSDLLRARRTAELAGFSPRLYPELREIHFGALEGALWETLDPRYKEALLRFQGFHPPGGESLSAFQERVFRFLEGLKAPAVLFTHGGVVRAVLRALGEDGLVPPGSAVAVDWPRRVLVRLALDGEEATG |
Method: X-RAY DIFFRACTION
Deposited Date: 2006-06-29 Deposition Author(s): Kunishima, N. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Sugahara, M.