Nmr structure of the first qrrm domain of human hnrnp f
PDB DOI: 10.2210/pdb2hgl/pdb
Classification: RNA BINDING PROTEIN Organism(s): Homo Sapiens
Deposited: 2006-06-27 Deposition Author(s): Allain, F.H.-T. , Dominguez, C.
Nmr structure of the first qrrm domain of human hnrnp f
Allain, F.H.-T. , Dominguez, C.
Primary Citation of Related Structures: 2HGL
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Heterogeneous nuclear ribonucleoprotein F | A | 136 | Homo Sapiens | MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMMLGPEGGEGFVVKLRGLPWSCSVEDVQNFLSDCTIHDGAAGVHFIYTREGRQSGEAFVELGSEDDVKMALKKDRESMGHRYIEVFKSHRTEMDWVLKHSGP |
Method: SOLUTION NMR
Deposited Date: 2006-06-27 Deposition Author(s): Allain, F.H.-T. , Dominguez, C.