2HEO
General structure-based approach to the design of protein ligands: application to the design of kv1.2 potassium channel blockers.
PDB DOI: 10.2210/pdb2heo/pdb
Classification: Immune System/DNA Organism(s): Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2006-06-21 Deposition Author(s): Charbonnier, J.B. , Cuniasse, P. , Gasparini, S. , Le Du, M.H. , Magis, C. , Menez, A. , Stura, E.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.7 Å
General structure-based approach to the design of protein ligands: application to the design of kv1.2 potassium channel blockers.
Charbonnier, J.B. , Cuniasse, P. , Gasparini, S. , Le Du, M.H. , Magis, C. , Menez, A. , Stura, E.
Primary Citation of Related Structures: 2HEO
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Z-DNA binding protein 1 | A | 67 | Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSHMLSTGDNLEQKILQVLSDDGGPVAIFQLVKKCQVPKKTLNQVLYRLKKEDRVSSPSPKYWSIGG |
| Z-DNA binding protein 1 | D | 67 | Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSHMLSTGDNLEQKILQVLSDDGGPVAIFQLVKKCQVPKKTLNQVLYRLKKEDRVSSPSPKYWSIGG |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2006-06-21 Deposition Author(s): Charbonnier, J.B. , Cuniasse, P. , Gasparini, S. , Le Du, M.H. , Magis, C. , Menez, A. , Stura, E.