Crystal structure of the selenocysteine to cysteine mutant of human glutathionine peroxidase 2 (gpx2)
PDB DOI: 10.2210/pdb2he3/pdb
Classification: OXIDOREDUCTASE Organism(s): Homo Sapiens
Deposited: 2006-06-21 Deposition Author(s): Arrowsmith, C. , Edwards, A. , Gileadi, O. , Johansson, C. , Kavanagh, K.L. , Oppermann, U. , Rojkova, A. , Structural Genomics Consortium (Sgc) , Sundstrom, M. , Von Delft, F. , Weigelt, J.
Crystal structure of the selenocysteine to cysteine mutant of human glutathionine peroxidase 2 (gpx2)
Arrowsmith, C. , Edwards, A. , Gileadi, O. , Johansson, C. , Kavanagh, K.L. , Oppermann, U. , Rojkova, A. , Structural Genomics Consortium (Sgc) , Sundstrom, M. , Von Delft, F. , Weigelt, J.
Primary Citation of Related Structures: 2HE3
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Glutathione peroxidase 2 | A | 208 | Homo Sapiens | MHHHHHHSSGVDLGTENLYFQSMIAKSFYDLSAINLDGEKVDFNTFRGRAVLIENVASLCGTTTRDFTQLNELQCRFPRRLVVLGFPCNQFGHQENCQNEEILNSLKYVRPGGGYQPTFTLVQKCEVNGQNEHPVFAYLKDKLPYPYDDPFSLMTDPKLIIWSPVRRSDVAWNFEKFLIGPEGEPFRRYSRTFPTINIEPDIKRLLKV |
Method: X-RAY DIFFRACTION
Deposited Date: 2006-06-21 Deposition Author(s): Arrowsmith, C. , Edwards, A. , Gileadi, O. , Johansson, C. , Kavanagh, K.L. , Oppermann, U. , Rojkova, A. , Structural Genomics Consortium (Sgc) , Sundstrom, M. , Von Delft, F. , Weigelt, J.