Structure of hiv protease 6x mutant in complex with ab-2.
PDB DOI: 10.2210/pdb2hc0/pdb
Classification: HYDROLASE Organism(s): Human Immunodeficiency Virus 1
Deposited: 2006-06-14 Deposition Author(s): Brik, A. , Elder, J.H. , Heaslet, H. , Lin, Y.-C. , Stout, C.D.
Structure of hiv protease 6x mutant in complex with ab-2.
Brik, A. , Elder, J.H. , Heaslet, H. , Lin, Y.-C. , Stout, C.D.
Primary Citation of Related Structures: 2HC0
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Protease | A | 99 | Human Immunodeficiency Virus 1 | PQITLWKRPLVTIKIGGQLKEALIDTGADDTVLEEMNLPGRWKPKIIGGIGGLIKVRQYDQIPIEICGHKAIGTVLIGPTPANIIGRNLLTQIGCTLNF |
| Protease | B | 99 | Human Immunodeficiency Virus 1 | PQITLWKRPLVTIKIGGQLKEALIDTGADDTVLEEMNLPGRWKPKIIGGIGGLIKVRQYDQIPIEICGHKAIGTVLIGPTPANIIGRNLLTQIGCTLNF |
Method: X-RAY DIFFRACTION
Deposited Date: 2006-06-14 Deposition Author(s): Brik, A. , Elder, J.H. , Heaslet, H. , Lin, Y.-C. , Stout, C.D.